In den Warenkorb
Bestellen Sie auch über:
 |
+33 (0)1 76 63 32 65 |
 |
+33 (0)1 74 18 08 22 |
Defensin, beta 4A (DEFB4) (AA 4-41) Antikörper
| Antigen | Defensin, beta 4A (DEFB4) |
| Synonyme |
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ...
mehr anzeigen
|
| Epitope |
 Alternativen AA 4-41 |
| Klonalität | Monoklonal (L12-4C-C2) |
| Wirt |
Alternativen Maus |
| Reaktivität |
Alternativen Human |
| Applikation |
Alternativen Enzyme Immunoassay (EIA), Immunhistochemie (Paraffinschnitte) (IHC (p)), Western Blot (WB)
|
| Produktnummer | ABIN191996 |
| Menge | 10 µg (Varianten) |
| Preis | 160,00 € Zzgl. Versandkosten €40,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferung in 7 bis 10 Werktagen |
Produktbeschreibung
| Produktmerkmale | Synonyms: Beta-defensin 4A, Beta-defensin 2, BD-2, hBD-2, DEFB102, DEFB2, Skin-antimicrobialpeptide 1, DEFB4B, DEFB4A |
| Weitere Bezeichnung | Defensin beta 2 |
| Swiss-Prot | O15263 |
| Immunogen | Synthetic peptide corresponding to amino acids 4-41 of Human beta-Defensin 2. AA Sequence: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP |
| Kreuzreaktivität | Human |
| Isotyp | IgG1 (Passende Sekundärantikörper) |
| Klon | L12-4C-C2 |
| Beschreibung | This antibiotic peptide is locally regulated by inflammation. Defensins form a family ofmicrobicidal and cytotoxic peptides made by neutrophils. Members of the defensin familyare highly similar in protein sequence. |
| Spezifität | This antibody recognizes beta-Defensin 2 (aa 4-41). Species Reactivity: Tested: Human. Add. Information: LocusID 1673 |
| Synonyme | SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2 |
Anwendungen
| Applikationshinweise | ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user. |
| Reinigung | Purified |
| Buffer | 50 mM TRIS pH 7.4Reconstitution: Restore in aqua bidest to 1 mg/ml. |
| Lagerung | Store lyophilized at 2-8°C and reconstituted at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch. |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "Defensin, beta 4A (DEFB4)", Typ "Antikörper" finden
| Wirte | Kaninchen (28), Maus (9), Schaf (8), Ziege (7) |
| Reaktivitäten | Human (35), Ratte (Rattus) (20), Maus (5), Rind (Kuh) (1) |
| Applikationen | Western Blot (WB) (23), Immunfluoreszenz (IF) (19), Durchflusszytometrie (FACS) (18), ELISA (16), Enzyme Immunoassay (EIA) (15), Immunhistochemie (Paraffinschnitte) (IHC (p)) (5), Radioimmunoassay (RIA) (5), Immunhistochemie (IHC) (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunpräzipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1) |
| Konjugate | Biotin (4), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1) |
| Epitope | AA 4-41 (12), AA 3-39 (4) |
