In den Warenkorb
Bestellen Sie auch über:
+33 (0)1 76 63 32 65
+33 (0)1 74 18 08 22

Brain Natriuretic Peptide (BNP) (AA 1-32) Antikörper

Antigen

Brain Natriuretic Peptide (BNP)

Synonyme BNP, AA408272, Bnf, BNP1, NPPB
Epitope
Alternativen

AA 1-32

Klonalität Monoklonal (17-16)
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen Enzyme Immunoassay (EIA)
Produktnummer ABIN191905
Menge 10 µg  (Varianten)
Preis 160,00 €   Zzgl. Versandkosten €40,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 7 bis 10 Werktagen

Produktbeschreibung

Weitere Bezeichnung Brain Natriuretic Peptide (BNP32)
Swiss-Prot P16860
Immunogen Synthetic human BNP (aa 1-32) KLH conjugatedAA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Kreuzreaktivität Human
Isotyp IgG1  (Passende Sekundärantikörper)
Klon 17-16
Beschreibung In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134 amino acid precursor(prepro-BNP), which is cleaved by proteases to form a 26 aa signal peptide and a 108 aapro-BNP. Proteolytic digestion of pro-BNP results in formation of 76 aa amino-terminalNT-proBNP and biologically active 32 aa BNP hormone molecule. Both proBNP andNTproBNP circulate in human plasma and have been proposed as markers for earlydiagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiaccomplications at patients with heart failure.
Spezifität This antibody detects synthetic BNP (aa 1-32) and recombinant proBNP (1-108). Species: Human. Others not tested. Add. Information: LocusID 4879

Anwendungen

Applikationshinweise ELISA. Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
Reinigung Purified
Buffer PBS pH 7,4Reconstitution: Restore in aqua bidest to 1 mg/ml.
Lagerung Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing. Shelf life: One year from despatch.
Forschungsgebiet Hormone
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Brain Natriuretic Peptide (BNP)", Typ "Antikörper" finden
Wirte Maus (39), Kaninchen (20)
Reaktivitäten Human (51), Ratte (Rattus) (6), Schwein (1)
Applikationen Enzyme Immunoassay (EIA) (28), ELISA (21), Radioimmunoassay (RIA) (15), Western Blot (WB) (14), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (6), Immunhistochemie (IHC) (6), ELISA (Detektionsantikörper) (4), Immunpräzipitation (IP) (4), ELISA (Fangantikörper) (1)
Konjugate Biotin (3), HRP (1)
Epitope AA 1-32 (26), AA 1-10 (5), AA 11-22 (3)