In den Warenkorb
Bestellen Sie auch über:
![]() |
+49 (0)241 95 163 153 |
![]() |
+49 (0)241 95 163 155 |
Defensin, beta 4A (DEFB4A) (AA 4-41) Antikörper
| Antigen | Defensin, beta 4A (DEFB4A) |
| Synonyme |
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ...
show more
|
| Epitope |
Alternativen AA 4-41 |
| Klonalität | Monoklonal (L12-4C-C2) |
| Wirt |
Alternativen Maus |
| Reaktivität |
Alternativen Human |
| Applikation |
Alternativen ELISA
|
| Produktnummer | ABIN109995 |
| Menge | 10 µg (Varianten) |
| Preis | 98,00 € Zzgl. Versandkosten €20,00 und MWSt |
| Lieferung nach |
|
| Verfügbarkeit | Lieferbar innerhalb von 3 bis 5 Werktagen |
Produktbeschreibung
| Weitere Bezeichnung | beta-Defensin 2 (aa 4-41) |
| Immunogen | Synthetic human 61538-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP) |
| Isotyp | IgG1 (Passende Sekundärantikörper) |
| Klon | L12-4C-C2 |
| Beschreibung | Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4 |
| Spezifität | Synthetic human 61538-Defensin 2 (aa 4-41) |
| Synonyme | SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2 |
Anwendungen
| Applikationshinweise | ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls. |
| Lagerung | 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided |
| Forschungsgebiet | Immunologie |
| Beschränkungen | Nur für Forschungszwecke einsetzbar |
Alternativen
Alternativen zu Antigen "Defensin, beta 4A (DEFB4A)", Typ "Antikörper" finden
| Wirte | Kaninchen (26), Maus (11), Schaf (8), Ziege (7) |
| Reaktivitäten | Human (34), Ratte (Rattus) (18), Maus (5), Rind (Kuh) (1) |
| Applikationen | Western Blot (WB) (27), ELISA (17), Enzyme Immunoassay (EIA) (16), Immunfluoreszenz (IF) (14), Durchflusszytometrie (FACS) (13), Radioimmunoassay (RIA) (5), Immunhistochemie (IHC) (4), Immunhistochemie (Paraffinschnitte) (IHC (p)) (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunpräzipitation (IP) (2), Dot Blot (Dot) (1), Immunelektronenmikroskopie (EM) (1) |
| Konjugate | Biotin (4), Alexa Flour 488 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), RBITC (1) |
| Epitope | AA 4-41 (12), AA 3-39 (5) |




Alternativen