In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

Defensin, beta 4A (DEFB4) (AA 4-41) Antikörper

Antigen

Defensin, beta 4A (DEFB4)

Synonyme
SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEF ... mehr anzeigen
Epitope
Alternativen

AA 4-41

Klonalität Monoklonal (L12-4C-C2)
Wirt
Reaktivität
Alternativen

Human

Applikation
Alternativen ELISA
Produktnummer ABIN109995
Menge 10 µg  (Varianten)
Preis 98,00 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 3 bis 5 Werktagen

Produktbeschreibung

Weitere Bezeichnung beta-Defensin 2 (aa 4-41)
Immunogen Synthetic human 61538-Defensin 2 (aa 4-41) (DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Isotyp IgG1  (Passende Sekundärantikörper)
Klon L12-4C-C2
Beschreibung Cell culture supernatant, protein G purified, 50 mM TRIS pH 7,4
Spezifität Synthetic human 61538-Defensin 2 (aa 4-41)
Synonyme SAP1, DEFB2, HBD-2, DEFB-2, DEFB102, MGC129140, MGC129141, MBD-4, 2310001F05Rik, Defb2, Defb3, BD-4, DEFB4, hBD-4, DEFB-4, DEFB104, MGC118942, MGC118944, MGC118945, GAL2, PBD-2, GAL4, BD2, DEFB4P, DEFB104A, THP2, DEFB104B, BD-2

Anwendungen

Applikationshinweise ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.
Lagerung 2-8 Degrees Celsius (lyophilized) - 20 Degrees Celsius (dissolved) Repeated thawing and freezing must be avoided
Forschungsgebiet Immunologie
Beschränkungen Nur für Forschungszwecke einsetzbar

Alternativen

Alternativen zu Antigen "Defensin, beta 4A (DEFB4)", Typ "Antikörper" finden
Wirte Kaninchen (26), Maus (8), Schaf (8), Ziege (6)
Reaktivitäten Human (32), Ratte (Rattus) (20), Maus (5), Rind (Kuh) (1)
Applikationen Western Blot (WB) (21), Durchflusszytometrie (FACS) (18), Immunfluoreszenz (IF) (18), ELISA (15), Enzyme Immunoassay (EIA) (13), Immunhistochemie (Paraffinschnitte) (IHC (p)) (6), Immunhistochemie (IHC) (4), Radioimmunoassay (RIA) (4), Immunhistochemie (Gefrierschnitte) (IHC (fro)) (3), Immunhistochemie (formalinfixierte Schnitte) (IHC (f)) (2), Immunpräzipitation (IP) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1)
Konjugate Biotin (4), Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)
Epitope AA 4-41 (12), AA 3-39 (4)