Transmembrane Protein 195 (TMEM195) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635387
Antigen
Epitop
N-Term
4
2
1
1
Reaktivität
Human
11
8
8
5
4
4
3
2
2
2
1
Wirt
Kaninchen
11
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
11
3
Optionen
Immunogen TMEM195 antibody was raised using the N terminal of TMEM195 corresponding to a region with amino acids VPDYVKKATPFFISLMLLELVVSWILKGKPPGRLDDALTSISAGVLSRLP
Spezifität TMEM195 antibody was raised against the N terminal of TMEM195
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM195 (TMEM195 Antibody Abstract)
Hintergrund TMEM195 belongs to the TMEM195 family. It is a multi-pass membrane protein.
Molekulargewicht 51 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM195 Blocking Peptide, catalog no. 33R-9719, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 195 (TMEM195) (N-Term) antibody (ABIN635387) TMEM195 antibody used at 1 ug/ml to detect target protein.