Lamin B Receptor Antikörper (Middle Region)
-
- Target Alle Lamin B Receptor (LBR) Antikörper anzeigen
- Lamin B Receptor (LBR)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Lamin B Receptor Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Lamin B Receptor antibody was raised against the middle region of LBR
- Aufreinigung
- Affinity purified
- Immunogen
- Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
- Top Product
- Discover our top product LBR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Lamin B Receptor Blocking Peptide, catalog no. 33R-3164, is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Lamin B Receptor (LBR)
- Andere Bezeichnung
- Lamin B Receptor (LBR Produkte)
- Hintergrund
- The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
- Molekulargewicht
- 71 kDa (MW of target protein)
-