Lamin B Receptor Antikörper (LBR) (Middle Region)

Details for Product anti-LBR Antibody No. ABIN635330
Antigen
Epitop
Middle Region
15
3
1
1
1
1
1
Reaktivität
Human
44
26
22
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
42
3
Klonalität
Polyklonal
Konjugat
Dieser Lamin B Receptor Antikörper ist unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
14
13
9
7
5
2
1
Optionen
Immunogen Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
Spezifität Lamin B Receptor antibody was raised against the middle region of LBR
Reinigung Affinity purified
Antigen
Andere Bezeichnung Lamin B Receptor (LBR Antibody Abstract)
Hintergrund The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Molekulargewicht 71 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Lamin B Receptor Blocking Peptide, catalog no. 33R-3164, is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Lamin B Receptor (LBR) (Middle Region) antibody (ABIN635330) Lamin B Receptor antibody used at 1 ug/ml to detect target protein.