Lamin B Receptor Antikörper (Middle Region)

Produktnummer ABIN635330

Produktdetails anti-Lamin B Receptor Antikörper

Target: Lamin B Receptor (LBR)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Lamin B Receptor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lamin B Receptor antibody was raised against the middle region of LBR

Aufreinigung: Affinity purified

Immunogen: Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lamin B Receptor Blocking Peptide, catalog no. 33R-3164, is also available for use as a blocking control in assays to test for specificity of this Lamin B Receptor antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Lamin B Receptor

Target: Lamin B Receptor (LBR)

Andere Bezeichnung: Lamin B Receptor (LBR Produkte)

Synonyme: CG17952 antikoerper, Dmel\\CG17952 antikoerper, dLBR antikoerper, sb:cb406 antikoerper, zgc:86649 antikoerper, wu:fb75h08 antikoerper, wu:fc47b04 antikoerper, wu:fd36b07 antikoerper, lbr-A antikoerper, Xp58 antikoerper, p58 gene antikoerper, LBR antikoerper, DHCR14B antikoerper, LMN2R antikoerper, PHA antikoerper, TDRD18 antikoerper, AI505894 antikoerper, ic antikoerper, Nbp60 antikoerper, lamin B receptor antikoerper, Lamin B receptor antikoerper, lamin B receptor S homeolog antikoerper, LBR antikoerper, lbr antikoerper, lbr.S antikoerper, Lbr antikoerper

Hintergrund: The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

Molekulargewicht: 71 kDa (MW of target protein)