MUC15 Antikörper (Mucin 15, Cell Surface Associated) (Middle Region)

Details for Product anti-MUC15 Antibody No. ABIN635309
Antigen
Epitop
Middle Region
11
11
8
1
1
1
Reaktivität
Human
51
21
17
2
2
2
2
2
1
1
Wirt
Kaninchen
51
Klonalität
Polyklonal
Konjugat
Dieser MUC15 Antikörper ist unkonjugiert
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
31
23
21
13
7
1
1
Optionen
Immunogen MUC15 antibody was raised using the middle region of MUC15 corresponding to a region with amino acids KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
Spezifität MUC15 antibody was raised against the middle region of MUC15
Reinigung Affinity purified
Antigen
Andere Bezeichnung MUC15 (MUC15 Antibody Abstract)
Hintergrund MUC15 may play a role in the cell adhesion to the extracellular matrix.
Molekulargewicht 36 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MUC15 Blocking Peptide, catalog no. 33R-4381, is also available for use as a blocking control in assays to test for specificity of this MUC15 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC15 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mucin 15, Cell Surface Associated (MUC15) (Middle Region) antibody (ABIN635309) MUC15 antibody used at 1 ug/ml to detect target protein.