MUL1 Antikörper (Middle Region)
-
- Target Alle MUL1 Antikörper anzeigen
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MUL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF166 antibody was raised against the middle region of C1 rf166
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
- Top Product
- Discover our top product MUL1 Primärantikörper
-
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 45-95) antibody
MUL1 Reaktivität: Human, Maus, Ratte WB, IF (p), FACS, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (Middle Region) antibodyMUL1 Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh) WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 176-210) antibodyMUL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB49942 unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 272-301), (C-Term) antibodyMUL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB32336 unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 1-352) antibodyMUL1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 1-352) antibodyMUL1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 143-192) antibodyMUL1 Reaktivität: Human, Maus, Hund, Meerschweinchen, Pferd, Kaninchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (AA 216-265) antibodyMUL1 Reaktivität: Human, Hund, Meerschweinchen, Pferd, Kaninchen, Rind (Kuh), Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF166 Blocking Peptide, catalog no. 33R-4589, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MUL1 (Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1))
- Andere Bezeichnung
- C1ORF166 (MUL1 Produkte)
- Hintergrund
- C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
- Molekulargewicht
- 40 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity
-
