MUL1 Antikörper (Mitochondrial E3 Ubiquitin Protein Ligase 1) (Middle Region)

Details for Product anti-MUL1 Antibody No. ABIN635254
Antigen
Epitop
Middle Region
10
9
8
6
3
1
1
1
1
1
Reaktivität
Human
79
51
40
4
4
4
4
3
2
1
1
Wirt
Kaninchen
77
2
Klonalität
Polyklonal
Konjugat
Dieser MUL1 Antikörper ist unkonjugiert
5
5
4
4
3
3
3
3
3
3
2
2
2
2
2
2
2
Applikation
Western Blotting (WB)
44
26
23
6
5
4
1
1
Optionen
Immunogen C1 ORF166 antibody was raised using the middle region of C1 rf166 corresponding to a region with amino acids KPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVG
Spezifität C1 ORF166 antibody was raised against the middle region of C1 rf166
Reinigung Affinity purified
Antigen
Andere Bezeichnung C1ORF166 (MUL1 Antibody Abstract)
Hintergrund C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Molekulargewicht 40 kDa (MW of target protein)
Pathways Positive Regulation of Endopeptidase Activity
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C1ORF166 Blocking Peptide, catalog no. 33R-4589, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF166 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (Middle Region) antibody (ABIN635254) C1ORF166 antibody used at 1 ug/ml to detect target protein.