ZDHHC16 Antikörper (C-Term)

Produktnummer ABIN635217

Produktdetails anti-ZDHHC16 Antikörper

Target: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ZDHHC16 antibody was raised against the C terminal of ZDHHC16

Aufreinigung: Affinity purified

Immunogen: ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC16 Blocking Peptide, catalog no. 33R-9668, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC16

Target: ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))

Andere Bezeichnung: ZDHHC16 (ZDHHC16 Produkte)

Synonyme: APH2 antikoerper, MGC132171 antikoerper, 1500015N03Rik antikoerper, Aph2 antikoerper, zdhhc16 antikoerper, zgc:66369 antikoerper, zgc:63934 antikoerper, zinc finger DHHC-type containing 16 antikoerper, zinc finger, DHHC-type containing 16 S homeolog antikoerper, zinc finger, DHHC-type containing 16 antikoerper, zinc finger, DHHC domain containing 16 antikoerper, zinc finger, DHHC-type containing 16a antikoerper, zinc finger, DHHC-type containing 16b antikoerper, ZDHHC16 antikoerper, zdhhc16.S antikoerper, Zdhhc16 antikoerper, zdhhc16 antikoerper, zdhhc16a antikoerper, zdhhc16b antikoerper

Hintergrund: ZDHHC16 may be involved in apoptosis regulation.

Molekulargewicht: 44 kDa (MW of target protein)