ZDHHC16 Antikörper (Zinc Finger, DHHC-Type Containing 16) (C-Term)

Details for Product anti-ZDHHC16 Antibody No. ABIN635217
Antigen
Epitop
C-Term
9
9
7
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
44
23
23
4
3
3
3
3
3
2
1
1
Wirt
Kaninchen
44
Klonalität
Polyklonal
Konjugat
Dieser ZDHHC16 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
29
17
13
4
3
Optionen
Immunogen ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
Spezifität ZDHHC16 antibody was raised against the C terminal of ZDHHC16
Reinigung Affinity purified
Antigen
Andere Bezeichnung ZDHHC16 (ZDHHC16 Antibody Abstract)
Hintergrund ZDHHC16 may be involved in apoptosis regulation.
Molekulargewicht 44 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ZDHHC16 Blocking Peptide, catalog no. 33R-9668, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Zinc Finger, DHHC-Type Containing 16 (ZDHHC16) (C-Term) antibody (ABIN635217) ZDHHC16 antibody used at 1 ug/ml to detect target protein.