ZDHHC16 Antikörper (C-Term)
-
- Target Alle ZDHHC16 Antikörper anzeigen
- ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZDHHC16 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZDHHC16 antibody was raised against the C terminal of ZDHHC16
- Aufreinigung
- Affinity purified
- Immunogen
- ZDHHC16 antibody was raised using the C terminal of ZDHHC16 corresponding to a region with amino acids VLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTG
- Top Product
- Discover our top product ZDHHC16 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZDHHC16 Blocking Peptide, catalog no. 33R-9668, is also available for use as a blocking control in assays to test for specificity of this ZDHHC16 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC16 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC16 (Zinc Finger, DHHC-Type Containing 16 (ZDHHC16))
- Andere Bezeichnung
- ZDHHC16 (ZDHHC16 Produkte)
- Synonyme
- APH2 antikoerper, MGC132171 antikoerper, 1500015N03Rik antikoerper, Aph2 antikoerper, zdhhc16 antikoerper, zgc:66369 antikoerper, zgc:63934 antikoerper, zinc finger DHHC-type containing 16 antikoerper, zinc finger, DHHC-type containing 16 S homeolog antikoerper, zinc finger, DHHC-type containing 16 antikoerper, zinc finger, DHHC domain containing 16 antikoerper, zinc finger, DHHC-type containing 16a antikoerper, zinc finger, DHHC-type containing 16b antikoerper, ZDHHC16 antikoerper, zdhhc16.S antikoerper, Zdhhc16 antikoerper, zdhhc16 antikoerper, zdhhc16a antikoerper, zdhhc16b antikoerper
- Hintergrund
- ZDHHC16 may be involved in apoptosis regulation.
- Molekulargewicht
- 44 kDa (MW of target protein)
-