FMO5 Antikörper (Flavin Containing Monooxygenase 5) (Middle Region)

Details for Product anti-FMO5 Antibody No. ABIN635212
Antigen
Epitop
Middle Region
16
9
8
3
3
1
1
1
Reaktivität
Human, Maus
64
34
25
2
2
2
2
1
1
1
Wirt
Kaninchen
60
4
Klonalität
Polyklonal
Konjugat
Dieser FMO5 Antikörper ist unkonjugiert
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
46
24
13
6
3
1
1
1
Optionen
Immunogen FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN
Spezifität FMO5 antibody was raised against the middle region of FMO5
Reinigung Affinity purified
Antigen
Andere Bezeichnung FMO5 (FMO5 Antibody Abstract)
Hintergrund Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.
Molekulargewicht 59 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FMO5 Blocking Peptide, catalog no. 33R-6751, is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Flavin Containing Monooxygenase 5 (FMO5) (Middle Region) antibody (ABIN635212) FMO5 antibody used at 1 ug/ml to detect target protein.