FMO5 Antikörper (Middle Region)
-
- Target Alle FMO5 Antikörper anzeigen
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FMO5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FMO5 antibody was raised against the middle region of FMO5
- Aufreinigung
- Affinity purified
- Immunogen
- FMO5 antibody was raised using the middle region of FMO5 corresponding to a region with amino acids NKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKVKGN
- Top Product
- Discover our top product FMO5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FMO5 Blocking Peptide, catalog no. 33R-6751, is also available for use as a blocking control in assays to test for specificity of this FMO5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMO5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FMO5 (Flavin Containing Monooxygenase 5 (FMO5))
- Andere Bezeichnung
- FMO5 (FMO5 Produkte)
- Synonyme
- MGC68633 antikoerper, MGC108355 antikoerper, sb:cb1007 antikoerper, wu:fc05b01 antikoerper, wu:fk47g04 antikoerper, 5033418D19Rik antikoerper, AI195026 antikoerper, flavin containing monooxygenase 5 S homeolog antikoerper, flavin containing monooxygenase 5 antikoerper, fmo5.S antikoerper, fmo5 antikoerper, MCYG_00559 antikoerper, FMO5 antikoerper, Fmo5 antikoerper
- Hintergrund
- Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity.
- Molekulargewicht
- 59 kDa (MW of target protein)
-