LPPR5 Antikörper (N-Term)
-
- Target Alle LPPR5 Antikörper anzeigen
- LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LPPR5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PAP2 D antibody was raised against the N terminal of PAP2
- Aufreinigung
- Affinity purified
- Immunogen
- PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
- Top Product
- Discover our top product LPPR5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LPPR5 (Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5))
- Andere Bezeichnung
- PAP2D (LPPR5 Produkte)
- Hintergrund
- PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Molekulargewicht
- 35 kDa (MW of target protein)
-