LPPR5 Antikörper (Lipid Phosphate Phosphatase-Related Protein Type 5) (N-Term)

Details for Product anti-LPPR5 Antibody No. ABIN635195
Antigen
Epitop
N-Term
9
8
7
7
2
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
36
16
7
4
4
3
3
3
2
2
1
1
Wirt
Kaninchen
36
Klonalität
Polyklonal
Konjugat
Dieser LPPR5 Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
19
4
2
1
1
Optionen
Immunogen PAP2 D antibody was raised using the N terminal of PAP2 corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
Spezifität PAP2 D antibody was raised against the N terminal of PAP2
Reinigung Affinity purified
Antigen
Andere Bezeichnung PAP2D (LPPR5 Antibody Abstract)
Hintergrund PAP2D is a type 2 member of the phosphatidic acid phosphatase (PAP) family. All type 2 members of this protein family contain 6 transmembrane regions, and a consensus N-glycosylation site. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Molekulargewicht 35 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PAP2D Blocking Peptide, catalog no. 33R-3109, is also available for use as a blocking control in assays to test for specificity of this PAP2D antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAP0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Lipid Phosphate Phosphatase-Related Protein Type 5 (LPPR5) (N-Term) antibody (ABIN635195) PAP2D antibody used at 1 ug/ml to detect target protein.