DLG3 Antikörper (Discs, Large Homolog 3 (Drosophila))

Details for Product anti-DLG3 Antibody No. ABIN635177
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
64
59
55
8
8
8
6
5
5
4
3
2
2
1
1
1
Wirt
Kaninchen
41
32
1
Klonalität
Polyklonal
Konjugat
Dieser DLG3 Antikörper ist unkonjugiert
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
65
33
31
27
25
24
11
6
3
3
2
2
1
Optionen
Immunogen DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG
Reinigung Affinity purified
Antigen
Andere Bezeichnung DLG3 (DLG3 Antibody Abstract)
Hintergrund DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
Molekulargewicht 58 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DLG3 Blocking Peptide, catalog no. 33R-3722, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Discs, Large Homolog 3 (Drosophila) (DLG3) antibody (ABIN635177) DLG3 antibody used at 1 ug/ml to detect target protein.