Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635159
Antigen
Epitop
Middle Region
4
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
23
19
19
2
2
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
23
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
13
7
5
3
1
1
Optionen
Immunogen SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL
Spezifität SLCO3 A1 antibody was raised against the middle region of SLCO3 1
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLCO3A1 (SLCO3A1 Antibody Abstract)
Hintergrund SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.
Molekulargewicht 76 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLCO3A1 Blocking Peptide, catalog no. 33R-5925, is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) antibody (ABIN635159) SLCO3A1 antibody used at 1 ug/ml to detect target protein.