Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) Antikörper
-
- Target Alle Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) Antikörper anzeigen
- Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLCO3 A1 antibody was raised against the middle region of SLCO3 1
- Aufreinigung
- Affinity purified
- Immunogen
- SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL
- Top Product
- Discover our top product SLCO3A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLCO3A1 Blocking Peptide, catalog no. 33R-5925, is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)
- Andere Bezeichnung
- SLCO3A1 (SLCO3A1 Produkte)
- Synonyme
- si:ch211-196l7.1 antikoerper, wu:fa93e11 antikoerper, OATP-D antikoerper, OATP3A1 antikoerper, OATPD antikoerper, SLC21A11 antikoerper, 5830414C08Rik antikoerper, Anr1 antikoerper, MJAM antikoerper, R75096 antikoerper, Slc21a11 antikoerper, solute carrier organic anion transporter family, member 3A1 antikoerper, solute carrier organic anion transporter family member 3A1 antikoerper, solute carrier organic anion transporter family, member 3a1 antikoerper, slco3a1 antikoerper, SLCO3A1 antikoerper, Slco3a1 antikoerper
- Hintergrund
- SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.
- Molekulargewicht
- 76 kDa (MW of target protein)
-