Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1) (Middle Region) Antikörper

Produktnummer ABIN635159

Produktdetails

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLCO3 A1 antibody was raised against the middle region of SLCO3 1

Aufreinigung: Affinity purified

Immunogen: SLCO3 A1 antibody was raised using the middle region of SLCO3 1 corresponding to a region with amino acids MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLCO3A1 Blocking Peptide, catalog no. 33R-5925, is also available for use as a blocking control in assays to test for specificity of this SLCO3A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Solute Carrier Organic Anion Transporter Family, Member 3A1 (SLCO3A1)

Andere Bezeichnung: SLCO3A1 (SLCO3A1 Produkte)

Hintergrund: SLCO3A1 mediates the Na+-independent transport of organic anions such as estrone-3-sulfate. It mediates transport of prostaglandins (PG) E1 and E2, thyroxine (T4), deltorphin II, BQ-123 and vasopressin, but not DPDPE (a derivative of enkephalin lacking an N-terminal tyrosine residue), estrone-3-sulfate, taurocholate, digoxin nor DHEAS.

Molekulargewicht: 76 kDa (MW of target protein)