DNAJC10 Antikörper
-
- Target Alle DNAJC10 Antikörper anzeigen
- DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DNAJC10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY
- Top Product
- Discover our top product DNAJC10 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DNAJC10 Blocking Peptide, catalog no. 33R-1941, is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))
- Andere Bezeichnung
- DNAJC10 (DNAJC10 Produkte)
- Synonyme
- ERdj5 antikoerper, JPDI antikoerper, MTHr antikoerper, PDIA19 antikoerper, 1200006L06Rik antikoerper, D2Ertd706e antikoerper, dnajc10 antikoerper, zgc:162218 antikoerper, DnaJ heat shock protein family (Hsp40) member C10 antikoerper, DnaJ (Hsp40) homolog, subfamily C, member 10 antikoerper, DNAJC10 antikoerper, Dnajc10 antikoerper, dnajc10 antikoerper
- Hintergrund
- This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
- Molekulargewicht
- 91 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-