DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) Antikörper

Details zu Produkt Nr. ABIN635149
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
55
47
28
4
3
3
3
2
2
1
1
1
1
Wirt
Kaninchen
65
7
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
48
30
13
13
5
3
1
Optionen
Immunogen DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY
Reinigung Affinity purified
Antigen
Andere Bezeichnung DNAJC10 (DNAJC10 Antibody Abstract)
Hintergrund This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.
Molekulargewicht 91 kDa (MW of target protein)
Pathways Cell RedoxHomeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

DNAJC10 Blocking Peptide, catalog no. 33R-1941, is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10) antibody (ABIN635149) DNAJC10 antibody used at 1 ug/ml to detect target protein.