Anoctamin 6 (ANO6) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635138
Antigen
Epitop
Middle Region
17
9
2
1
1
1
1
1
Reaktivität
Human
29
5
4
3
2
2
1
1
1
1
1
Wirt
Kaninchen
28
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
28
15
2
2
2
1
Optionen
Immunogen Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
Spezifität Anoctamin 6 antibody was raised against the middle region of ANO6
Reinigung Affinity purified
Antigen
Andere Bezeichnung Anoctamin 6 (ANO6 Antibody Abstract)
Hintergrund TMEM16F may act as a calcium-activated chloride channel.
Molekulargewicht 106 kDa (MW of target protein)
Pathways SARS-CoV-2 Protein Interaktom
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Anoctamin 6 (ANO6) (Middle Region) antibody (ABIN635138) Anoctamin 6 antibody used at 1 ug/ml to detect target protein.