Anoctamin 6 Antikörper (Middle Region)

Produktnummer ABIN635138

Produktdetails anti-Anoctamin 6 Antikörper

Target: Anoctamin 6 (ANO6)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Anoctamin 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Anoctamin 6 antibody was raised against the middle region of ANO6

Aufreinigung: Affinity purified

Immunogen: Anoctamin 6 antibody was raised using the middle region of ANO6 corresponding to a region with amino acids KSKGNPYSDLGNHTTCRYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Anoctamin 6 Blocking Peptide, catalog no. 33R-4651, is also available for use as a blocking control in assays to test for specificity of this Anoctamin 6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANO6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Anoctamin 6

Target: Anoctamin 6 (ANO6)

Andere Bezeichnung: Anoctamin 6 (ANO6 Produkte)

Synonyme: TMEM16F antikoerper, 2900059G15Rik antikoerper, AA407480 antikoerper, AW554778 antikoerper, F730003B03Rik antikoerper, Tmem16f antikoerper, BDPLT7 antikoerper, SCTS antikoerper, anoctamin 6 antikoerper, ANO6 antikoerper, ano6 antikoerper, Ano6 antikoerper

Hintergrund: TMEM16F may act as a calcium-activated chloride channel.

Molekulargewicht: 106 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom