OR5T2 Antikörper (Olfactory Receptor, Family 5, Subfamily T, Member 2) (C-Term)

Details for Product anti-OR5T2 Antibody No. ABIN635104
Antigen
Epitop
C-Term
4
Reaktivität
Human
5
1
1
1
1
1
1
1
Wirt
Kaninchen
5
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
5
1
Optionen
Immunogen OR5 T2 antibody was raised using the C terminal of OR5 2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
Spezifität OR5 T2 antibody was raised against the C terminal of OR5 2
Reinigung Affinity purified
Antigen
Andere Bezeichnung OR5T2 (OR5T2 Antibody Abstract)
Hintergrund Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.
Molekulargewicht 39 kDa (MW of target protein)
Applikations-hinweise WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2) (C-Term) antibody (ABIN635104) OR5T2 antibody used at 0.25 ug/ml to detect target protein.