OR5T2 Antikörper (C-Term)

Produktnummer ABIN635104

Produktdetails anti-OR5T2 Antikörper

Target: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR5T2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR5 T2 antibody was raised against the C terminal of OR5 2

Aufreinigung: Affinity purified

Immunogen: OR5 T2 antibody was raised using the C terminal of OR5 2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR5T2

Target: OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))

Andere Bezeichnung: OR5T2 (OR5T2 Produkte)

Synonyme: OR11-177 antikoerper, olfactory receptor family 5 subfamily T member 2 antikoerper, olfactory receptor, family 5, subfamily T, member 2 antikoerper, olfactory receptor 1086-like antikoerper, OR5T2 antikoerper, LOC100727026 antikoerper

Hintergrund: Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.

Molekulargewicht: 39 kDa (MW of target protein)