OR5T2 Antikörper (C-Term)
-
- Target Alle OR5T2 Antikörper anzeigen
- OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OR5T2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OR5 T2 antibody was raised against the C terminal of OR5 2
- Aufreinigung
- Affinity purified
- Immunogen
- OR5 T2 antibody was raised using the C terminal of OR5 2 corresponding to a region with amino acids DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
- Top Product
- Discover our top product OR5T2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OR5T2 Blocking Peptide, catalog no. 33R-2075, is also available for use as a blocking control in assays to test for specificity of this OR5T2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR5T2 (Olfactory Receptor, Family 5, Subfamily T, Member 2 (OR5T2))
- Andere Bezeichnung
- OR5T2 (OR5T2 Produkte)
- Hintergrund
- Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals.
- Molekulargewicht
- 39 kDa (MW of target protein)
-