Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635103
Antigen
Epitop
Middle Region
10
9
7
1
1
1
Reaktivität
Human
36
1
Wirt
Kaninchen
36
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
24
14
13
3
Optionen
Immunogen NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV
Spezifität NYD-SP21 antibody was raised against the middle region of Nyd-Sp21
Reinigung Affinity purified
Antigen
Andere Bezeichnung NYD-SP21 (MS4A14 Antibody Abstract)
Hintergrund NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.
Molekulargewicht 76 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NYD-SP21 Blocking Peptide, catalog no. 33R-7792, is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14) (Middle Region) antibody (ABIN635103) NYD-SP21 antibody used at 1 ug/ml to detect target protein.