MS4A14 Antikörper (Middle Region)
-
- Target Alle MS4A14 Antikörper anzeigen
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MS4A14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NYD-SP21 antibody was raised against the middle region of Nyd-Sp21
- Aufreinigung
- Affinity purified
- Immunogen
- NYD-SP21 antibody was raised using the middle region of Nyd-Sp21 corresponding to a region with amino acids QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV
- Top Product
- Discover our top product MS4A14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NYD-SP21 Blocking Peptide, catalog no. 33R-7792, is also available for use as a blocking control in assays to test for specificity of this NYD-SP21 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NYD-SP21 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MS4A14 (Membrane-Spanning 4-Domains, Subfamily A, Member 14 (MS4A14))
- Andere Bezeichnung
- NYD-SP21 (MS4A14 Produkte)
- Hintergrund
- NYD-SP21 may be involved in signal transduction as a component of a multimeric receptor complex.
- Molekulargewicht
- 76 kDa (MW of target protein)
-