SLC25A11 Antikörper

Produktnummer ABIN635080

Produktdetails anti-SLC25A11 Antikörper

Target: SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC25 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A11 Blocking Peptide, catalog no. 33R-1955, is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A11

Target: SLC25A11 (Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11))

Andere Bezeichnung: SLC25A11 (SLC25A11 Produkte)

Synonyme: SLC25A11 antikoerper, 2310022P18Rik antikoerper, 2oxoc antikoerper, fa07h09 antikoerper, wu:fa07h09 antikoerper, zgc:86898 antikoerper, OGC antikoerper, SLC20A4 antikoerper, solute carrier family 25 member 11 antikoerper, solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 antikoerper, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 antikoerper, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 L homeolog antikoerper, SLC25A11 antikoerper, Slc25a11 antikoerper, slc25a11 antikoerper, slc25a11.L antikoerper

Hintergrund: SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport