Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11) Antikörper

Details zu Produkt Nr. ABIN635080
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
64
41
41
4
4
4
4
4
4
3
2
2
2
1
1
Wirt
Kaninchen
60
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
3
3
3
3
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
39
20
13
13
6
2
1
1
Optionen
Immunogen SLC25 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A11 (SLC25A11 Antibody Abstract)
Hintergrund SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
Molekulargewicht 34 kDa (MW of target protein)
Pathways Dicarboxylic Acid Transport
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A11 Blocking Peptide, catalog no. 33R-1955, is also available for use as a blocking control in assays to test for specificity of this SLC25A11 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25 (Mitochondrial Carrier, Oxoglutarate Carrier), Member 11 (SLC25A11) antibody (ABIN635080) SLC25A11 antibody used at 1 ug/ml to detect target protein.