Transmembrane Protein 195 (TMEM195) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635006
Antigen
Epitop
Middle Region
5
1
1
1
Reaktivität
Human
11
8
8
5
4
4
3
2
2
2
1
Wirt
Kaninchen
11
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
11
3
Optionen
Immunogen TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
Spezifität TMEM195 antibody was raised against the middle region of TMEM195
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM195 (TMEM195 Antibody Abstract)
Hintergrund TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
Molekulargewicht 51 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM195 Blocking Peptide, catalog no. 33R-1200, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Transmembrane Protein 195 (TMEM195) (Middle Region) antibody (ABIN635006) TMEM195 antibody used at 1 ug/ml to detect target protein.