ATG9A Antikörper

Produktnummer ABIN634988

Produktdetails anti-ATG9A Antikörper

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATG9A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATG9A

Target: ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))

Andere Bezeichnung: ATG9A (ATG9A Produkte)

Synonyme: ATG9 antikoerper, ATG9A antikoerper, zgc:158700 antikoerper, APG9L1 antikoerper, DKFZp459N117 antikoerper, MGD3208 antikoerper, mATG9 antikoerper, AU019532 antikoerper, Apg9l1 antikoerper, Atg9 antikoerper, Atg9l1 antikoerper, RGD1310450 antikoerper, autophagy related 9A antikoerper, ATG9 autophagy related 9 homolog A (S. cerevisiae) antikoerper, ATG9A antikoerper, atg9a antikoerper, Atg9a antikoerper

Hintergrund: ATG9A belongs to the ATG9 family. It plays a role in autophagy.

Molekulargewicht: 94 kDa (MW of target protein)