ATG9A Antikörper (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae))

Details for Product anti-ATG9A Antibody No. ABIN634988
Antigen
Reaktivität
Human
111
70
57
5
3
3
3
3
2
2
1
1
1
Wirt
Kaninchen
109
2
2
Klonalität
Polyklonal
Konjugat
Dieser ATG9A Antikörper ist unkonjugiert
5
4
4
4
4
4
4
3
3
2
2
2
2
2
1
1
1
Applikation
Western Blotting (WB)
66
39
34
26
18
11
4
2
2
1
1
1
1
Optionen
Immunogen ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
Reinigung Affinity purified
Antigen
Andere Bezeichnung ATG9A (ATG9A Antibody Abstract)
Hintergrund ATG9A belongs to the ATG9 family. It plays a role in autophagy.
Molekulargewicht 94 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A) antibody (ABIN634988) ATG9A antibody used at 1 ug/ml to detect target protein.