IL22 Receptor alpha 1 Antikörper (Middle Region)
-
- Target Alle IL22 Receptor alpha 1 (IL22RA1) Antikörper anzeigen
- IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IL22 Receptor alpha 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IL22 R alpha 1 antibody was raised against the middle region of IL22 A1
- Aufreinigung
- Affinity purified
- Immunogen
- IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids YRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQ
- Top Product
- Discover our top product IL22RA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IL22R alpha 1 Blocking Peptide, catalog no. 33R-10235, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL22 Receptor alpha 1 (IL22RA1) (Interleukin 22 Receptor, alpha 1 (IL22RA1))
- Andere Bezeichnung
- IL22R alpha 1 (IL22RA1 Produkte)
- Synonyme
- IL22RA1 antikoerper, CRF2-9 antikoerper, IL22R antikoerper, IL22R1 antikoerper, 9130219A07Rik antikoerper, ENSMUSG00000073746 antikoerper, IL-22R antikoerper, Il22r antikoerper, RGD1559655 antikoerper, interleukin 22 receptor subunit alpha 1 antikoerper, interleukin 22 receptor, alpha 1 antikoerper, IL22RA1 antikoerper, Il22ra1 antikoerper
- Hintergrund
- IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4).
- Molekulargewicht
- 63 kDa (MW of target protein)
-