FJX1 Antikörper (Four Jointed Box 1 (Drosophila))

Details for Product anti-FJX1 Antibody No. ABIN634941
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
11
7
5
2
2
1
1
1
1
Wirt
Kaninchen
11
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
11
3
3
1
1
1
1
Optionen
Immunogen FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
Reinigung Affinity purified
Antigen
Andere Bezeichnung FJX1 (FJX1 Antibody Abstract)
Hintergrund FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.
Molekulargewicht 48 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

FJX1 Blocking Peptide, catalog no. 33R-6577, is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Four Jointed Box 1 (Drosophila) (FJX1) antibody (ABIN634941) FJX1 antibody used at 0.5 ug/ml to detect target protein.