FJX1 Antikörper
-
- Target Alle FJX1 Antikörper anzeigen
- FJX1 (Four Jointed Box 1 (FJX1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FJX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
- Top Product
- Discover our top product FJX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FJX1 Blocking Peptide, catalog no. 33R-6577, is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FJX1 (Four Jointed Box 1 (FJX1))
- Andere Bezeichnung
- FJX1 (FJX1 Produkte)
- Hintergrund
- FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.
- Molekulargewicht
- 48 kDa (MW of target protein)
-