Mucin 3B, Cell Surface Associated (MUC3B) (N-Term) Antikörper

Details zu Produkt Nr. ABIN634921
Antigen
Epitop
N-Term
9
9
8
7
3
2
1
1
1
1
Reaktivität
Human
31
2
2
2
1
1
1
1
1
Wirt
Kaninchen
31
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
30
18
17
3
1
1
Optionen
Immunogen MUC3 B antibody was raised using the N terminal of MUC3 corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD
Spezifität MUC3 B antibody was raised against the N terminal of MUC3
Reinigung Affinity purified
Antigen
Andere Bezeichnung MUC3B
Hintergrund MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Molekulargewicht 35 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MUC3B Blocking Peptide, catalog no. 33R-6182, is also available for use as a blocking control in assays to test for specificity of this MUC3B antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mucin 3B, Cell Surface Associated (MUC3B) (N-Term) antibody (ABIN634921) MUC3B antibody used at 0.5 ug/ml to detect target protein.