Zinc Finger, DHHC-Type Containing 19 (ZDHHC19) (N-Term) Antikörper

Details zu Produkt Nr. ABIN634916
Antigen
Epitop
N-Term
3
2
1
1
Reaktivität
Human
8
2
1
1
1
1
1
Wirt
Kaninchen
8
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
8
1
Optionen
Immunogen ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
Spezifität ZDHHC19 antibody was raised against the N terminal of ZDHHC19
Reinigung Affinity purified
Antigen
Andere Bezeichnung ZDHHC19
Hintergrund ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
Molekulargewicht 34 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ZDHHC19 Blocking Peptide, catalog no. 33R-9177, is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Zinc Finger, DHHC-Type Containing 19 (ZDHHC19) (N-Term) antibody (ABIN634916) ZDHHC19 antibody used at 1 ug/ml to detect target protein.