ZDHHC19 Antikörper (N-Term)
-
- Target Alle ZDHHC19 Produkte
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZDHHC19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZDHHC19 antibody was raised against the N terminal of ZDHHC19
- Aufreinigung
- Affinity purified
- Immunogen
- ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZDHHC19 Blocking Peptide, catalog no. 33R-9177, is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))
- Andere Bezeichnung
- ZDHHC19 (ZDHHC19 Produkte)
- Synonyme
- RGD1560310 antikoerper, Gm1744 antikoerper, Gm616 antikoerper, DHHC19 antikoerper, zinc finger, DHHC-type containing 19 antikoerper, zinc finger DHHC-type containing 19 antikoerper, zinc finger, DHHC domain containing 19 antikoerper, Zdhhc19 antikoerper, ZDHHC19 antikoerper
- Hintergrund
- ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.
- Molekulargewicht
- 34 kDa (MW of target protein)
-