Occludin Antikörper (OCLN) (N-Term)

Details for Product anti-OCLN Antibody No. ABIN634908
Antigen
Epitop
N-Term
26
15
11
8
6
6
4
4
4
4
4
3
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus), Hund
144
85
77
18
13
4
4
4
3
2
2
2
Wirt
Kaninchen
125
26
3
Klonalität
Polyklonal
Konjugat
Dieser Occludin Antikörper ist unkonjugiert
11
6
6
6
5
5
5
5
5
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
113
66
41
24
20
13
9
9
7
4
4
4
2
1
1
Optionen
Immunogen Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA
Spezifität Occludin antibody was raised against the N terminal of OCLN
Reinigung Affinity purified
Antigen
Andere Bezeichnung Occludin (OCLN Antibody Abstract)
Hintergrund OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
Molekulargewicht 59 kDa (MW of target protein)
Pathways Cell-Cell Junction Organization, Hepatitis C
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Occludin Blocking Peptide, catalog no. 33R-9782, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.