Occludin Antikörper (N-Term)

Produktnummer ABIN634908

Produktdetails anti-Occludin Antikörper

Target: Occludin (OCLN)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Occludin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Occludin antibody was raised against the N terminal of OCLN

Aufreinigung: Affinity purified

Immunogen: Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Occludin Blocking Peptide, catalog no. 33R-9782, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Occludin

Target: Occludin (OCLN)

Andere Bezeichnung: Occludin (OCLN Produkte)

Synonyme: AI503564 antikoerper, Ocl antikoerper, ocln antikoerper, oclnb antikoerper, tpmt antikoerper, OCLN antikoerper, wu:fd23h10 antikoerper, wu:fi13c01 antikoerper, zgc:113992 antikoerper, zgc:56359 antikoerper, BLCPMG antikoerper, occludin antikoerper, occludin S homeolog antikoerper, occludin a antikoerper, Ocln antikoerper, OCLN antikoerper, ocln.S antikoerper, ocln antikoerper, oclna antikoerper

Hintergrund: OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization, Hepatitis C