LMF2 Antikörper (Middle Region)

Produktnummer ABIN634844

Produktdetails anti-LMF2 Antikörper

Target: LMF2 (Lipase Maturation Factor 2 (LMF2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LMF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LMF2 antibody was raised against the middle region of LMF2

Aufreinigung: Affinity purified

Immunogen: LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LMF2

Target: LMF2 (Lipase Maturation Factor 2 (LMF2))

Andere Bezeichnung: LMF2 (LMF2 Produkte)

Hintergrund: LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.

Molekulargewicht: 77 kDa (MW of target protein)