LMF2 Antikörper (Lipase Maturation Factor 2) (Middle Region)

Details for Product anti-LMF2 Antibody No. ABIN634844
Antigen
Epitop
Middle Region
9
9
8
4
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
28
7
6
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
28
Klonalität
Polyklonal
Konjugat
Dieser LMF2 Antikörper ist unkonjugiert
3
3
3
2
2
2
Applikation
Western Blotting (WB)
25
23
16
4
1
1
1
Optionen
Immunogen LMF2 antibody was raised using the middle region of LMF2 corresponding to a region with amino acids YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS
Spezifität LMF2 antibody was raised against the middle region of LMF2
Reinigung Affinity purified
Antigen
Andere Bezeichnung LMF2 (LMF2 Antibody Abstract)
Hintergrund LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
Molekulargewicht 77 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LMF2 Blocking Peptide, catalog no. 33R-10273, is also available for use as a blocking control in assays to test for specificity of this LMF2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LMF2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Lipase Maturation Factor 2 (LMF2) (Middle Region) antibody (ABIN634844) LMF2 antibody used at 1 ug/ml to detect target protein.