Enkephalin Antikörper (Proenkephalin) (Middle Region)

Details for Product anti-PENK Antibody No. ABIN634799
Antigen
Epitop
Middle Region
15
8
7
7
3
3
2
2
2
2
1
1
1
1
Reaktivität
Human
64
13
9
5
5
2
2
2
1
1
1
1
1
Wirt
Kaninchen
60
12
8
Klonalität
Polyklonal
Konjugat
Dieser Enkephalin Antikörper ist unkonjugiert
5
4
3
3
3
3
1
1
1
1
1
1
Applikation
Western Blotting (WB)
52
45
38
15
11
10
9
6
5
4
3
3
2
Optionen
Immunogen PENK antibody was raised using the middle region of PENK corresponding to a region with amino acids DAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRG
Spezifität PENK antibody was raised against the middle region of PENK
Reinigung Affinity purified
Antigen
Andere Bezeichnung PENK (PENK Antibody Abstract)
Hintergrund Met- and Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress.
Molekulargewicht 31 kDa (MW of target protein)
Pathways Stem Cell Maintenance
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PENK Blocking Peptide, catalog no. 33R-1846, is also available for use as a blocking control in assays to test for specificity of this PENK antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PENK antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Proenkephalin (PENK) (Middle Region) antibody (ABIN634799) PENK antibody used at 1 ug/ml to detect target protein.