GDF2 Antikörper (Middle Region)
-
- Target Alle GDF2 Antikörper anzeigen
- GDF2 (Growth Differentiation Factor 2 (GDF2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GDF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GDF2 antibody was raised against the middle region of GDF2
- Aufreinigung
- Affinity purified
- Immunogen
- GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
- Top Product
- Discover our top product GDF2 Primärantikörper
-
anti-Growth Differentiation Factor 2 (GDF2) (AA 32-427) antibody
GDF2 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 8-37), (N-Term) antibodyGDF2 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB2206 unconjugated
anti-Growth Differentiation Factor 2 (GDF2) antibodyGDF2 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 351-429) antibodyGDF2 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC (p), IF (cc), IF (p), IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 320-419) antibodyGDF2 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 300-429) antibodyGDF2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) antibodyGDF2 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 320-429) antibodyGDF2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 320-419) antibodyGDF2 Reaktivität: Human ELISA Wirt: Maus Monoclonal 4D2 unconjugated
anti-Growth Differentiation Factor 2 (GDF2) (AA 360-409) antibodyGDF2 Reaktivität: Human, Maus, Pferd, Schwein, Kaninchen, Rind (Kuh), Meerschweinchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GDF2 Blocking Peptide, catalog no. 33R-1682, is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GDF2 (Growth Differentiation Factor 2 (GDF2))
- Andere Bezeichnung
- GDF2 (GDF2 Produkte)
- Synonyme
- bmp9 antikoerper, BMP-9 antikoerper, BMP9 antikoerper, Bmp9 antikoerper, DSL1 antikoerper, growth differentiation factor 2 antikoerper, gdf2 antikoerper, GDF2 antikoerper, Gdf2 antikoerper
- Hintergrund
- GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-
