GDF2 Antikörper (Growth Differentiation Factor 2) (Middle Region)

Details for Product anti-GDF2 Antibody No. ABIN634786
Antigen
Epitop
Middle Region
7
7
4
4
4
4
2
2
2
2
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
92
50
25
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
81
9
9
1
Klonalität
Polyklonal
Konjugat
Dieser GDF2 Antikörper ist unkonjugiert
9
6
4
4
4
4
4
4
3
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
54
41
25
13
13
8
6
4
4
3
3
3
2
1
1
Optionen
Immunogen GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
Spezifität GDF2 antibody was raised against the middle region of GDF2
Reinigung Affinity purified
Antigen
Andere Bezeichnung GDF2 (GDF2 Antibody Abstract)
Hintergrund GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.
Molekulargewicht 47 kDa (MW of target protein)
Pathways Transition Metal Ion Homeostasis
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

GDF2 Blocking Peptide, catalog no. 33R-1682, is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Growth Differentiation Factor 2 (GDF2) (Middle Region) antibody (ABIN634786) GDF2 antibody used at 1 ug/ml to detect target protein.