APP Antikörper (Middle Region)
-
- Target Alle APP Antikörper anzeigen
- APP (Amyloid beta (A4) Precursor Protein (APP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APP antibody was raised against the middle region of APP
- Aufreinigung
- Affinity purified
- Immunogen
- APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
- Top Product
- Discover our top product APP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APP (Amyloid beta (A4) Precursor Protein (APP))
- Andere Bezeichnung
- APP (APP Produkte)
- Synonyme
- AAA antikoerper, ABETA antikoerper, ABPP antikoerper, AD1 antikoerper, APPI antikoerper, CTFgamma antikoerper, CVAP antikoerper, PN-II antikoerper, PN2 antikoerper, aaa antikoerper, abeta antikoerper, abpp antikoerper, ad1 antikoerper, appi antikoerper, ctfgamma antikoerper, cvap antikoerper, pn2 antikoerper, APP antikoerper, APP-like antikoerper, APPL antikoerper, Abeta antikoerper, BcDNA:GH04413 antikoerper, CG7727 antikoerper, Dmel\\CG7727 antikoerper, EG:65F1.5 antikoerper, appl antikoerper, Abpp antikoerper, Adap antikoerper, Ag antikoerper, Cvap antikoerper, E030013M08Rik antikoerper, betaApp antikoerper, app antikoerper, wu:fj34d10 antikoerper, wu:fk65e12 antikoerper, zgc:85740 antikoerper, amyloid beta precursor protein antikoerper, amyloid beta (A4) precursor protein antikoerper, beta amyloid protein precursor-like antikoerper, amyloid beta (A4) precursor protein a antikoerper, amyloid beta precursor protein L homeolog antikoerper, APP antikoerper, app antikoerper, Appl antikoerper, App antikoerper, appa antikoerper, app.L antikoerper
- Hintergrund
- APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Molekulargewicht
- 85 kDa (MW of target protein)
- Pathways
- Caspase Kaskade in der Apoptose, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
-