APP Antikörper (Amyloid beta (A4) Precursor Protein) (Middle Region)

Details for Product anti-APP Antibody No. ABIN634767
Antigen
Epitop
Middle Region
84
74
60
37
34
29
19
17
15
13
12
12
10
10
10
10
8
8
8
7
7
7
7
6
5
5
5
5
4
4
4
4
4
4
4
4
3
3
3
3
3
3
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
809
333
328
39
20
18
15
14
12
11
11
7
5
4
2
2
2
2
2
2
1
Wirt
Kaninchen
592
210
32
8
1
Klonalität
Polyklonal
Konjugat
Dieser APP Antikörper ist unkonjugiert
53
38
36
16
16
16
16
14
14
13
13
13
10
10
10
10
10
3
3
2
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
562
335
302
124
122
89
56
50
40
23
17
16
15
10
8
3
3
3
2
1
1
Optionen
Immunogen APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
Spezifität APP antibody was raised against the middle region of APP
Reinigung Affinity purified
Antigen
Andere Bezeichnung APP (APP Antibody Abstract)
Hintergrund APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Molekulargewicht 85 kDa (MW of target protein)
Pathways Caspase Kaskade in der Apoptose, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.