APP Antikörper (Middle Region)
-
- Target Alle APP Antikörper anzeigen
- APP (Amyloid beta (A4) Precursor Protein (APP))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APP antibody was raised against the middle region of APP
- Aufreinigung
- Affinity purified
- Immunogen
- APP antibody was raised using the middle region of APP corresponding to a region with amino acids RMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYG
- Top Product
- Discover our top product APP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APP Blocking Peptide, catalog no. 33R-8067, is also available for use as a blocking control in assays to test for specificity of this APP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APP (Amyloid beta (A4) Precursor Protein (APP))
- Andere Bezeichnung
- APP (APP Produkte)
- Hintergrund
- APP is a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
- Molekulargewicht
- 85 kDa (MW of target protein)
- Pathways
- Caspase Kaskade in der Apoptose, EGFR Signaling Pathway, Transition Metal Ion Homeostasis, Skeletal Muscle Fiber Development, Toll-Like Receptors Cascades, Feeding Behaviour
-