PCDHA10 Antikörper (Protocadherin alpha 10) (N-Term)

Details for Product anti-PCDHA10 Antibody No. ABIN634739
Antigen
Epitop
N-Term
9
8
7
4
3
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
30
6
6
3
3
2
2
2
Wirt
Kaninchen
24
6
Klonalität
Polyklonal
Konjugat
Dieser PCDHA10 Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
30
21
4
2
Optionen
Immunogen PCDHA10 antibody was raised using the N terminal of PCDHA10 corresponding to a region with amino acids DKDKFPVLVLRKLLDREENPQLKLLLTATDGGKPEFTGSVSLLILVLDAN
Spezifität PCDHA10 antibody was raised against the N terminal of PCDHA10
Reinigung Affinity purified
Antigen
Andere Bezeichnung PCDHA10 (PCDHA10 Antibody Abstract)
Hintergrund This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster.
Molekulargewicht 73 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PCDHA10 Blocking Peptide, catalog no. 33R-2014, is also available for use as a blocking control in assays to test for specificity of this PCDHA10 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHA10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Protocadherin alpha 10 (PCDHA10) (N-Term) antibody (ABIN634739) PCDHA10 antibody used at 1 ug/ml to detect target protein.