ZCRB1 Antikörper (N-Term)
-
- Target Alle ZCRB1 Antikörper anzeigen
- ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZCRB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZCRB1 antibody was raised against the N terminal of ZCRB1
- Aufreinigung
- Affinity purified
- Immunogen
- ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
- Top Product
- Discover our top product ZCRB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZCRB1 Blocking Peptide, catalog no. 33R-6428, is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCRB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZCRB1 (Zinc Finger CCHC-Type and RNA Binding Motif 1 (ZCRB1))
- Andere Bezeichnung
- ZCRB1 (ZCRB1 Produkte)
- Synonyme
- MADP-1 antikoerper, madp1 antikoerper, rbm36 antikoerper, madp-1 antikoerper, zcchc19 antikoerper, MADP1 antikoerper, RBM36 antikoerper, SNRNP31 antikoerper, ZCCHC19 antikoerper, 2700088M22Rik antikoerper, Madp-1 antikoerper, RGD1309851 antikoerper, si:ch211-155a11.4 antikoerper, zgc:110711 antikoerper, zinc finger CCHC-type and RNA binding motif containing 1 antikoerper, zinc finger CCHC-type and RNA binding motif 1 antikoerper, zinc finger CCHC-type and RNA binding motif containing 1 L homeolog antikoerper, ZCRB1 antikoerper, zcrb1 antikoerper, Zcrb1 antikoerper, zcrb1.L antikoerper
- Hintergrund
- Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.
- Molekulargewicht
- 24 kDa (MW of target protein)
-