Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

ZCRB1 Antikörper (Zinc Finger CCHC-Type and RNA Binding Motif 1) (N-Term) Primary Antibody

ZCRB1 Reaktivität: Human, Maus, Ratte WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN633544
$672.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    ZCRB1
    Bindungsspezifität
    N-Term
    • 14
    • 8
    • 8
    • 2
    • 1
    Reaktivität
    Human, Maus, Ratte
    • 25
    • 16
    • 6
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    Wirt
    Kaninchen
    • 24
    • 1
    Klonalität
    Polyklonal
    • 25
    Konjugat
    Dieser ZCRB1 Antikörper ist unkonjugiert
    • 13
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    Applikation
    Western Blotting (WB)
    • 25
    • 19
    • 14
    • 14
    • 3
    • 2
    • 2
    Spezifität
    ZCRB1 antibody was raised against the N terminal of ZCRB1
    Aufreinigung
    Affinity purified
    Immunogen
    ZCRB1 antibody was raised using the N terminal of ZCRB1 corresponding to a region with amino acids MSGGLAPSKSTVYVSNLPFSLTNNDLYRIFSKYGKVVKVTIMKDKDTRKS
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    ZCRB1 Blocking Peptide, catalog no. 33R-6428, is also available for use as a blocking control in assays to test for specificity of this ZCRB1 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZCRB1 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    ZCRB1
    Andere Bezeichnung
    ZCRB1 (ZCRB1 Antibody Abstract)
    Synonyme
    MADP-1, madp1, rbm36, madp-1, zcchc19, MADP1, RBM36, SNRNP31, ZCCHC19, 2700088M22Rik, Madp-1, RGD1309851, si:ch211-155a11.4, zgc:110711, zinc finger CCHC-type and RNA binding motif containing 1, zinc finger CCHC-type and RNA binding motif 1, zinc finger CCHC-type and RNA binding motif containing 1 L homeolog, ZCRB1, zcrb1, Zcrb1, zcrb1.L
    Hintergrund
    Pre-mRNA splicing is catalyzed by the spliceosome. U12-type spliceosome binds U12-type pre-mRNAs and recognises the 5' splice site and branch-point sequence.
    Molekulargewicht
    24 kDa (MW of target protein)
Sie sind hier:
help Kundenservice