Telefon:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antikoerper-online.de

F-Box Protein 10 (FBXO10) (Middle Region) Antikörper Primary Antibody

FBXO10 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN632180
$647.32
Zzgl. Versandkosten $45.00
50 μg
local_shipping Lieferung nach: Vereinigte Staaten von Amerika
Lieferung in 9 bis 11 Werktagen
  • Target
    F-Box Protein 10 (FBXO10)
    Bindungsspezifität
    Middle Region
    • 1
    • 1
    • 1
    • 1
    • 1
    Reaktivität
    Human
    • 7
    • 3
    • 3
    • 3
    • 2
    • 1
    Wirt
    Kaninchen
    • 7
    • 1
    Klonalität
    Polyklonal
    • 7
    Applikation
    Western Blotting (WB)
    • 6
    • 3
    • 3
    Spezifität
    FBXO10 antibody was raised against the middle region of FBXO10
    Aufreinigung
    Affinity purified
    Immunogen
    FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    FBXO10 Blocking Peptide, catalog no. 33R-8851, is also available for use as a blocking control in assays to test for specificity of this FBXO10 antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO10 antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    F-Box Protein 10 (FBXO10)
    Andere Bezeichnung
    FBXO10 (FBXO10 Antibody Abstract)
    Synonyme
    FBXO10, LOC563863, FBX10, PRMT11, Gm634, F-box protein 10, FBXO10, fbxo10, Fbxo10
    Hintergrund
    Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.
    Molekulargewicht
    105 kDa (MW of target protein)
Sie sind hier:
help Kundenservice