ARSE Antikörper

Antigen: ARSE

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN636061

Produktbeschreibung

Immunogen: ARSE antibody was raised using a synthetic peptide corresponding to a region with amino acids KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS

Beschreibung: Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.

Molekulargewicht: 62 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARSE antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Organogenese, Organelle