KDELR3 Antikörper

Produktnummer ABIN636049

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch KDELR3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für KDELR3 Antikörper (ABIN636049)

Target: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KDELR3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KDELR3 Antikörper

Aufreinigung: Affinity purified

Immunogen: KDELR3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVTVYMIYGKFRKTFDSENDTFRLEFLLVPVIGLSFLENYSFTLLEILW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KDELR3 Blocking Peptide, (ABIN937021), is also available for use as a blocking control in assays to test for specificity of this KDELR3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KDELR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KDELR3

Target: KDELR3 (kDELR3) (KDEL (Lys-Asp-Glu-Leu) Endoplasmic Reticulum Protein Retention Receptor 3 (kDELR3))

Andere Bezeichnung: KDELR3

Hintergrund: Retention of resident soluble proteins in the lumen of the endoplasmic reticulum (ER) is achieved in both yeast and animal cells by their continual retrieval from the cis-Golgi, or a pre-Golgi compartment. Sorting of these proteins is dependent on a C-terminal tetrapeptide signal, usually lys-asp-glu-leu (kDaEL) in animal cells, and his-asp-glu-leu (HDEL) in S. cerevisiae. This process is mediated by a receptor that recognises, and binds the tetrapeptide-containing protein, and returns it to the ER. In yeast, the sorting receptor encoded by a single gene, ERD2, is a seven-transmembrane protein. Unlike yeast, several human homologs of the ERD2 gene, constituting the kDaEL receptor gene family, have been described. kDaELR3 was the third member of the family to be identified, and it encodes a protein highly homologous to kDaELR1 and kDaELR2 proteins.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling, Maintenance of Protein Location