SLC35A3 Antikörper

Produktnummer ABIN635941

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC35A3 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC35A3 Antikörper (ABIN635941)

Target: SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC35A3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC35 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35A3 Blocking Peptide, (ABIN5616235), is also available for use as a blocking control in assays to test for specificity of this SLC35A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35A3

Target: SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))

Andere Bezeichnung: SLC35A3

Hintergrund: SLC35A3 is a uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.

Molekulargewicht: 36 kDa (MW of target protein)