MBOAT7 Antikörper (C-Term)

Produktnummer ABIN635931

Der Kaninchen Polyklonal anti-MBOAT7 Antikörper (ABIN635931) detektiert spezifisch MBOAT7 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für MBOAT7 Antikörper (C-Term) (ABIN635931)

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBOAT7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBOAT7 Antikörper

Bindungsspezifität: C-Term

Spezifität: LENG4 antibody was raised against the C terminal Of Leng4

Aufreinigung: Affinity purified

Immunogen: LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids WWLAQYIYKSAPARSYVLRSAWTMLLSAYWHGLHPGYYLSFLTIPLCLAA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LENG4 Blocking Peptide, (ABIN935993), is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBOAT7

Target: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Andere Bezeichnung: LENG4

Hintergrund: MBOAT7 belongs to the membrane-bound acyltransferase family. It is involved in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils.

Molekulargewicht: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process