Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 7 (SLC9A7) Antikörper

Antigen: Solute Carrier Family 9 (Sodium/hydrogen Exchanger), Member 7 (SLC9A7)

Synonyme: Nhe7, nhe7, slc9a6

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN635882

Produktbeschreibung

Weitere Bezeichnung: SLC9A7

Immunogen: SLC9A7 antibody was raised using a synthetic peptide corresponding to a region with amino acids LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Beschreibung: Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.

Molekulargewicht: 80 kDa (MW of target protein)

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC9A7 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Signaltransduktion, Metabolismus, Organelle