In den Warenkorb
Bestellen Sie auch über:
+49 (0)241 95 163 153
+49 (0)241 95 163 155

ADAM Metallopeptidase Domain 30 (ADAM30) Antikörper

Antigen

ADAM Metallopeptidase Domain 30 (ADAM30)

Synonyme svph4, MGC132801, MGC132802, 4933424D07Rik
Klonalität Polyklonal
Wirt
Alternativen

Kaninchen

Applikation
Alternativen Western Blot (WB)
Produktnummer ABIN635861
Menge 50 ug  (1 mg/ml)  (Varianten)
Preis 432,69 €   Zzgl. Versandkosten €20,00 und MWSt
Lieferung nach
Verfügbarkeit Lieferung in 5 bis 7 Werktagen

Produktbeschreibung

Weitere Bezeichnung ADAM30
Immunogen ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
Beschreibung ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins.
Molekulargewicht 66 kDa (MW of target protein)

Anwendungen

Konzentration 1 mg/ml
Reinigung Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM30 antibody in PBS
Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Forschungsgebiet Proteolyse / Ubiquitin, Metalloprotease, Extrazelluläre Matrix

Alternativen

Alternativen zu Antigen "ADAM Metallopeptidase Domain 30 (ADAM30)", Typ "Antikörper" finden
Wirte Kaninchen (9), Maus (2)
Reaktivitäten Human (10), Hund (1)
Applikationen Western Blot (WB) (8), ELISA (4), Enzyme Immunoassay (EIA) (3), Dot Blot (Dot) (1), Durchflusszytometrie (FACS) (1), Immunhistochemie (IHC) (1)
Epitope C-Term (2)