beta-Site APP-Cleaving Enzyme 1 (BACE) Antikörper

Antigen: beta-Site APP-Cleaving Enzyme 1 (BACE)

Synonyme: ASP2, BACE, HSPC104, FLJ90568, KIAA1149, C76936, Bace, bace1, MGC77409, BACE1, MGC137940, MGC145931, Bace1, ASP1, BAE2, DRAP, AEPLC, ALP56, ASP21, CDA13, CEAP1, ARP1, AI850424, 1110059C24Rik, bace2, MGC68881, MGC68482, BACE2

Klonalität: Polyklonal

Wirt: Kaninchen

Applikation: Western Blot (WB)

Produktnummer: ABIN635849

Produktbeschreibung

Weitere Bezeichnung: BACE1

Immunogen: BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Beschreibung: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Molekulargewicht: 51 kDa (MW of target protein)

Synonyme: ASP2, BACE, HSPC104, FLJ90568, KIAA1149, C76936, Bace, bace1, MGC77409, BACE1, MGC137940, MGC145931, Bace1, ASP1, BAE2, DRAP, AEPLC, ALP56, ASP21, CDA13, CEAP1, ARP1, AI850424, 1110059C24Rik, bace2, MGC68881, MGC68482, BACE2

Anwendungen

Konzentration: 1 mg/ml

Reinigung: Affinity purified

Buffer: Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BACE1 antibody in PBS

Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Forschungsgebiet: Proteolyse / Ubiquitin, Alzheimer-Krankheit (Morbus Alzheimer), Enzyme