SLC9A1 Antikörper

Produktnummer ABIN635841

Der Kaninchen Polyklonal anti-SLC9A1 Antikörper (ABIN635841) detektiert spezifisch SLC9A1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SLC9A1 Antikörper (ABIN635841)

Target: SLC9A1 (Solute Carrier Family 9, Subfamily A (NHE1, Cation Proton Antiporter 1), Member 1 (SLC9A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC9A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC9A1 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC9 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC9A1 Blocking Peptide, (ABIN5616281), is also available for use as a blocking control in assays to test for specificity of this SLC9A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC9A1

Target: SLC9A1 (Solute Carrier Family 9, Subfamily A (NHE1, Cation Proton Antiporter 1), Member 1 (SLC9A1))

Andere Bezeichnung: SLC9A1

Hintergrund: The Na+/H+ antiporter (SLC9A1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors and mitogens.

Molekulargewicht: 91 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Proton Transport