Membrane transport protein XK (XK) Antikörper

Produktnummer ABIN635742

Der Kaninchen Polyklonal anti-Membrane transport protein XK Antikörper (ABIN635742) detektiert spezifisch Membrane transport protein XK in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Membrane transport protein XK (XK) Antikörper (ABIN635742)

Target: Membrane transport protein XK (XK)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Aufreinigung: Affinity purified

Immunogen: XK antibody was raised using a synthetic peptide corresponding to a region with amino acids LHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XK Blocking Peptide, (ABIN940403), is also available for use as a blocking control in assays to test for specificity of this XK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Membrane transport protein XK (XK)

Andere Bezeichnung: XK

Hintergrund: This locus controls the synthesis of the Kell blood group 'precursor substance' (Kx). Mutations in this gene have been associated with McLeod syndrome, an X-linked, recessive disorder characterized by abnormalities in the neuromuscular and hematopoietic systems. XK has structural characteristics of prokaryotic and eukaryotic membrane transport proteins.

Molekulargewicht: 51 kDa (MW of target protein)