CLN8 Antikörper

Produktnummer ABIN635688

Der Kaninchen Polyklonal anti-CLN8 Antikörper (ABIN635688) detektiert spezifisch CLN8 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Hund.

Kurzübersicht für CLN8 Antikörper (ABIN635688)

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLN8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CLN8 Antikörper

Aufreinigung: Affinity purified

Immunogen: CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFGVQSTAAGLWALLGDPVLHADKARGQQNWCWFHITTATGFFCFENVAV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CLN8 Blocking Peptide, (ABIN5612935), is also available for use as a blocking control in assays to test for specificity of this CLN8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLN8

Target: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Andere Bezeichnung: CLN8

Hintergrund: CLN8 is a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Dicarboxylic Acid Transport