P4HTM Antikörper (Middle Region)

Produktnummer ABIN635662

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch P4HTM in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für P4HTM Antikörper (Middle Region) (ABIN635662)

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P4HTM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-P4HTM Antikörper

Bindungsspezifität: Middle Region

Spezifität: PH4 antibody was raised against the middle region of PH-4

Aufreinigung: Affinity purified

Immunogen: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PH4 Blocking Peptide, (ABIN938707), is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P4HTM

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Andere Bezeichnung: PH4

Hintergrund: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Molekulargewicht: 57 kDa (MW of target protein)