ZDHHC18 Antikörper (Middle Region)

Produktnummer ABIN635642

Der Kaninchen Polyklonal anti-ZDHHC18 Antikörper wird verwendet zum Nachweis von ZDHHC18 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ZDHHC18 Antikörper (Middle Region) (ABIN635642)

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZDHHC18 Antikörper

Bindungsspezifität: Middle Region

Spezifität: ZDHHC18 antibody was raised against the middle region of ZDHHC18

Aufreinigung: Affinity purified

Immunogen: ZDHHC18 antibody was raised using the middle region of ZDHHC18 corresponding to a region with amino acids SFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC18 Blocking Peptide, (ABIN5617093), is also available for use as a blocking control in assays to test for specificity of this ZDHHC18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC18

Target: ZDHHC18 (Zinc Finger, DHHC-Type Containing 18 (ZDHHC18))

Andere Bezeichnung: ZDHHC18

Hintergrund: ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.

Molekulargewicht: 42 kDa (MW of target protein)