SLC6A2 Antikörper

Produktnummer ABIN635638

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC6A2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte und Maus.

Kurzübersicht für SLC6A2 Antikörper (ABIN635638)

Target: SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC6A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC6A2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC6 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC6A2 Blocking Peptide, (ABIN5616273), is also available for use as a blocking control in assays to test for specificity of this SLC6A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC6A2

Target: SLC6A2 (Solute Carrier Family 6 (Neurotransmitter Transporter, Noradrenalin), Member 2 (SLC6A2))

Andere Bezeichnung: SLC6A2

Hintergrund: The SLC6A2 gene encodes a norepinephrine (noradrenaline) transporter, which is responsible for reuptake of norepinephrine into presynaptic nerve terminals and is a regulator of norepinephrine homeostasis.

Molekulargewicht: 69 kDa (MW of target protein)