SLC22A8 Antikörper

Produktnummer ABIN635617

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SLC22A8 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für SLC22A8 Antikörper (ABIN635617)

Target: SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC22A8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC22A8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC22 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A8 Blocking Peptide, (ABIN5616204), is also available for use as a blocking control in assays to test for specificity of this SLC22A8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC22A8

Target: SLC22A8 (Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8))

Andere Bezeichnung: SLC22A8

Hintergrund: SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.

Molekulargewicht: 60 kDa (MW of target protein)