ZDHHC24 Antikörper (N-Term)

Produktnummer ABIN635580

Der Kaninchen Polyklonal anti-ZDHHC24 Antikörper (ABIN635580) detektiert spezifisch ZDHHC24 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für ZDHHC24 Antikörper (N-Term) (ABIN635580)

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ZDHHC24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ZDHHC24 Antikörper

Bindungsspezifität: N-Term

Spezifität: ZDHHC24 antibody was raised against the N terminal of ZDHHC24

Aufreinigung: Affinity purified

Immunogen: ZDHHC24 antibody was raised using the N terminal of ZDHHC24 corresponding to a region with amino acids YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ZDHHC24 Blocking Peptide, (ABIN936258), is also available for use as a blocking control in assays to test for specificity of this ZDHHC24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ZDHHC24

Target: ZDHHC24 (Zinc Finger, DHHC-Type Containing 24 (ZDHHC24))

Andere Bezeichnung: ZDHHC24

Hintergrund: The function of ZDHHC24 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 30 kDa (MW of target protein)