UNC5A Antikörper

Produktnummer ABIN635530

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch UNC5A in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für UNC5A Antikörper (ABIN635530)

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UNC5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UNC5A Antikörper

Aufreinigung: Affinity purified

Immunogen: UNC5 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLLTIQPDLSTTTT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC5A Blocking Peptide, (ABIN5616911), is also available for use as a blocking control in assays to test for specificity of this UNC5A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UNC5A

Target: UNC5A (Unc-5 Homolog A (UNC5A))

Andere Bezeichnung: UNC5A

Hintergrund: UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.UNC5A belongs to a family of netrin-1 receptors thought to mediate the chemorepulsive effect of netrin-1 on specific axons.

Molekulargewicht: 93 kDa (MW of target protein)