ATP4b Antikörper (Middle Region)

Produktnummer ABIN635524

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ATP4b in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und Hund.

Kurzübersicht für ATP4b Antikörper (Middle Region) (ABIN635524)

Target: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP4b Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATP4b Antikörper

Bindungsspezifität: Middle Region

Spezifität: ATP4 B antibody was raised against the middle region of ATP4

Aufreinigung: Affinity purified

Immunogen: ATP4 B antibody was raised using the middle region of ATP4 corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP4B Blocking Peptide, (ABIN5612220), is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP4b

Target: ATP4b (ATPase, H+/K+ Exchanging, beta Polypeptide (ATP4b))

Andere Bezeichnung: ATP4B

Hintergrund: ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: Proton Transport