ODF4 Antikörper (N-Term)

Produktnummer ABIN635515

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch ODF4 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für ODF4 Antikörper (N-Term) (ABIN635515)

Target: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ODF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ODF4 Antikörper

Bindungsspezifität: N-Term

Spezifität: ODF4 antibody was raised against the N terminal of ODF4

Aufreinigung: Affinity purified

Immunogen: ODF4 antibody was raised using the N terminal of ODF4 corresponding to a region with amino acids MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ODF4 Blocking Peptide, (ABIN5615116), is also available for use as a blocking control in assays to test for specificity of this ODF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ODF4

Target: ODF4 (Outer Dense Fiber of Sperm Tails 4 (ODF4))

Andere Bezeichnung: ODF4

Hintergrund: ODF4 is the component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton.

Molekulargewicht: 29 kDa (MW of target protein)